WNK1 Polyclonal AntibodyWNK1 Polyclonal Antibody
Move your mouse over image or click to enlarge

WNK1 Polyclonal Antibody

Cat# Size Price Qty Buy
A14196-200ul 200ul
£332.50
A14196-100ul 100ul
£192.50
A14196-50ul 50ul
£113.75
A14196-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14196
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names WNK1; HSAN2; HSN2; KDP; PPP1R167; PRKWNK1; PSK; p65; serine/threonine-protein kinase WNK1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human WNK1 (NP_055638.2).
Reactivity Mouse, Rat
Gene ID 65125
Calculated MW 206kDa/225kDa/250kDa/279kDa/299kDa
Observed MW 300kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MSGGAAEKQSSTPGSLFLSPPAPAPKNGSSSDSSVGEKLGAAAADAVTGRTEEYRRRRHTMDKDSRGAAATTTTTEHRFFRRSVICDSNATALELPGLPLSLPQPSIPAAVPQSAPPEPHREETVTATATSQVAQQPPAAAAPGEQAVAGPAPSTVPSSTSKDRPVSQPSLVGSKEEPPPARSGSGGGSAKEPQEERSQQQDDIEELETK
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents