WBSCR16 Polyclonal AntibodyWBSCR16 Polyclonal Antibody
Move your mouse over image or click to enlarge

WBSCR16 Polyclonal Antibody

Cat# Size Price Qty Buy
A14330-200ul 200ul
£332.50
A14330-100ul 100ul
£192.50
A14330-50ul 50ul
£113.75
A14330-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14330
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names RCC1L; WBSCR16; RCC1 like
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human WBSCR16 (NP_110425.2).
Reactivity Human, Mouse, Rat
Gene ID 81554
Calculated MW 38kDa/48kDa/49kDa
Observed MW 50kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MALVALVAGARLGRRLSGPGLGRGHWTAAGRSRSRREAAEAEAEVPVVQYVGERAARADRVFVWGFSFSGALGVPSFVVPSSGPGPRAGARPRRRIQPVPYRLELDQKISSAACGYGFTLLSSKTADVTKVWGMGLNKDSQLGFHRSRKDKTRGYEYVLEPSPVSLPLDRPQETRVLQVSCGRAHSLVLTDREGVFSMGNNSYGQCGRKVVENEIYSESHRVHRMQDFDG
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents