VTN Polyclonal AntibodyVTN Polyclonal Antibody
Move your mouse over image or click to enlarge

VTN Polyclonal Antibody

Cat# Size Price Qty Buy
A13561-200ul 200ul
£332.50
A13561-100ul 100ul
£192.50
A13561-50ul 50ul
£113.75
A13561-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13561
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names VTN; V75; VN; VNT; vitronectin
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 399-478 of human VTN (NP_000629.3).
Reactivity Human, Mouse, Rat
Gene ID 7448
Calculated MW 54kDa
Observed MW 70kDa
Physical Appearance liquid
Purification Affinity purification
Sequence ATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents