VPS54 Polyclonal AntibodyVPS54 Polyclonal Antibody
Move your mouse over image or click to enlarge

VPS54 Polyclonal Antibody

Cat# Size Price Qty Buy
A13215-200ul 200ul
£332.50
A13215-100ul 100ul
£192.50
A13215-50ul 50ul
£113.75
A13215-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13215
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names VPS54; HCC8; PPP1R164; SLP-8p; VPS54L; WR; hVps54L; VPS54, GARP complex subunit
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 420-720 of human VPS54 (NP_001005739.1).
Reactivity Human, Mouse
Gene ID 51542
Calculated MW 15kDa/93kDa/109kDa/110kDa
Observed MW 110kDa
Physical Appearance liquid
Purification Affinity purification
Sequence VVKLADQMRMLNFPQWFDLLKDIFSKFTIFLQRVKATLNIIHSVVLSVLDKNQRTRELEEISQQKNAAKDNSLDTEVAYLIHEGMFISDAFGEGELTPIAVDTTSQRNASPNSEPCSSDSVSEPECTTDSSSSKEHTSSSAIPGGVDIMVSEDMKLTDSELGKLANNIQELLYSASDICHDRAVKFLMSRAKDGFLEKLNSMEFITLSRLMETFILDTEQICGRKSTSLLGALQSQAIKFVNRFHEERKTKLSLLLDNERWKQADVPAEFQDLVDSLSDGKIALPEKKSGATEERKPAEVL
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents