VPS4A Polyclonal AntibodyVPS4A Polyclonal Antibody
Move your mouse over image or click to enlarge

VPS4A Polyclonal Antibody

Cat# Size Price Qty Buy
A13416-200ul 200ul
£332.50
A13416-100ul 100ul
£192.50
A13416-50ul 50ul
£113.75
A13416-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13416
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names VPS4A; SKD1; SKD1A; SKD2; VPS4; VPS4-1; vacuolar protein sorting 4 homolog A
Applications IF
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human VPS4A (NP_037377.1).
Reactivity Human
Gene ID 27183
Calculated MW 48kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MTTSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLRSKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVME
Sensitivity IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents