VAMP4 Polyclonal AntibodyVAMP4 Polyclonal Antibody
Move your mouse over image or click to enlarge

VAMP4 Polyclonal Antibody

Cat# Size Price Qty Buy
A4241-200ul 200ul
£332.50
A4241-100ul 100ul
£192.50
A4241-50ul 50ul
£113.75
A4241-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4241
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names VAMP4; VAMP-4; VAMP24; vesicle-associated membrane protein 4
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human VAMP4 (NP_003753.2).
Reactivity Human, Mouse, Rat
Gene ID 8674
Calculated MW 16kDa
Observed MW 16kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCK
Sensitivity WB,1:200 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents