USP6 Polyclonal AntibodyUSP6 Polyclonal Antibody
Move your mouse over image or click to enlarge

USP6 Polyclonal Antibody

Cat# Size Price Qty Buy
A13255-200ul 200ul
£332.50
A13255-100ul 100ul
£192.50
A13255-50ul 50ul
£113.75
A13255-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13255
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names USP6; HRP1; TRE17; TRE2; TRESMCR; Tre-2; USP6-short; ubiquitin specific peptidase 6
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 55-120 of human USP6 (NP_004496.2).
Reactivity Human
Gene ID 9098
Calculated MW 89kDa/121kDa/158kDa
Observed MW Refer to Figures
Physical Appearance liquid
Purification Affinity purification
Sequence ELPPVTAREAKKIRREMTRTSKWMEMLGEWETYKHSSKLIDRVYKGIPMNIRGPVWSVLLNIQEIK
Sensitivity WB,1:1000 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents