USO1 Polyclonal AntibodyUSO1 Polyclonal Antibody
Move your mouse over image or click to enlarge

USO1 Polyclonal Antibody

Cat# Size Price Qty Buy
A16079-20ul 20ul
£77.00
A16079-50ul 50ul
£113.75
A16079-100ul 100ul
£192.50
A16079-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16079
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names USO1; P115; TAP; VDP; USO1 vesicle transport factor
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 663-962 of human USO1 (NP_003706.2).
Reactivity Human, Rat
Gene ID 8615
Calculated MW 107kDa/109kDa
Observed MW 108kDa
Physical Appearance liquid
Purification Affinity purification
Sequence DLQLEELRQQVSTLKCQNEQLQTAVTQQVSQIQQHKDQYNLLKIQLGKDNQHQGSYSEGAQMNGIQPEEIGRLREEIEELKRNQELLQSQLTEKDSMIENMKSSQTSGTNEQSSAIVSARDSEQVAELKQELATLKSQLNSQSVEITKLQTEKQELLQKTEAFAKSVEVQGETETIIATKTTDVEGRLSALLQETKELKNEIKALSEERTAIKEQLDSSNSTIAILQTEKDKLELEITDSKKEQDDLLVLLADQDQKILSLKNKLKDLGHPVEEEDELESGDQEDEDDESEDPGKDLDHI
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:100|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents