USH1C Polyclonal AntibodyUSH1C Polyclonal Antibody
Move your mouse over image or click to enlarge

USH1C Polyclonal Antibody

Cat# Size Price Qty Buy
A4368-200ul 200ul
£332.50
A4368-100ul 100ul
£192.50
A4368-50ul 50ul
£113.75
A4368-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4368
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names USH1C; AIE-75; DFNB18; DFNB18A; NY-CO-37; NY-CO-38; PDZ-45; PDZ-73; PDZ-73/NY-CO-38; PDZ73; PDZD7C; ush1cpst; harmonin
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of zebrafish USH1C (NP_001035018.1).
Reactivity Human, Mouse, Rat
Gene ID 564412
Calculated MW 45kDa/58kDa/60kDa/62kDa/101kDa
Observed MW 73kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MERKVAREFRHKVELLIDNEAEKDYLYDVLRMYHQSMDLPVLVGDLKLVINEPKRLPLFDAIRPLIPLKHQVQYDQLTPKRSRKLKEVRLDRTHPEGLGL
Sensitivity WB,1:200 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents