URM1 Polyclonal AntibodyURM1 Polyclonal Antibody
Move your mouse over image or click to enlarge

URM1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13817-200ul 200ul
£332.50
A13817-100ul 100ul
£192.50
A13817-50ul 50ul
£113.75
A13817-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13817
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names URM1; C9orf74; ubiquitin-related modifier 1
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human URM1 (NP_001252511.1).
Reactivity Mouse, Rat
Gene ID 81605
Calculated MW 7kDa/11kDa/15kDa
Observed MW 11kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAAPLSVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSV
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents