UGGT1 Polyclonal AntibodyUGGT1 Polyclonal Antibody
Move your mouse over image or click to enlarge

UGGT1 Polyclonal Antibody

Cat# Size Price Qty Buy
A4866-200ul 200ul
£332.50
A4866-100ul 100ul
£192.50
A4866-50ul 50ul
£113.75
A4866-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4866
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names UGGT1; HUGT1; UGCGL1; UGT1; UDP-glucose:glycoprotein glucosyltransferase 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1456-1555 of human UGGT1 (NP_064505.1).
Reactivity Human, Mouse, Rat
Gene ID 56886
Calculated MW 174kDa/177kDa
Observed MW 177kDa
Physical Appearance liquid
Purification Affinity purification
Sequence PNNMIHQVPIKSLPQEWLWCETWCDDASKKRAKTIDLCNNPMTKEPKLEAAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEKTKEPSREGPQKREEL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents