UFC1 Polyclonal AntibodyUFC1 Polyclonal Antibody
Move your mouse over image or click to enlarge

UFC1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13192-200ul 200ul
£332.50
A13192-100ul 100ul
£192.50
A13192-50ul 50ul
£113.75
A13192-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13192
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names UFC1; HSPC155; ubiquitin-fold modifier-conjugating enzyme 1
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-167 of human UFC1 (NP_057490.2).
Reactivity Human, Mouse, Rat
Gene ID 51506
Calculated MW 19kDa
Observed MW 19kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKYEFDIEFDIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQHKEKCNQ
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents