UBQLN4 Polyclonal AntibodyUBQLN4 Polyclonal Antibody
Move your mouse over image or click to enlarge

UBQLN4 Polyclonal Antibody

Cat# Size Price Qty Buy
A15869-20ul 20ul
£77.00
A15869-50ul 50ul
£113.75
A15869-100ul 100ul
£192.50
A15869-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15869
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names UBQLN4; A1U; A1Up; C1orf6; CIP75; UBIN; ubiquilin-4
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 300-390 of human UBQLN4 (NP_064516.2).
Reactivity Human
Gene ID 56893
Calculated MW 24kDa/63kDa
Observed MW 75kDa
Physical Appearance liquid
Purification Affinity purification
Sequence QFGNNPFSSLAGNSDSSSSQPLRTENREPLPNPWSPSPPTSQAPGSGGEGTGGSGTSQVHPTVSNPFGINAASLGSGMFNSPEMQALLQQI
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents