UBIAD1 Polyclonal AntibodyUBIAD1 Polyclonal Antibody
Move your mouse over image or click to enlarge

UBIAD1 Polyclonal Antibody

Cat# Size Price Qty Buy
A14214-200ul 200ul
£332.50
A14214-100ul 100ul
£192.50
A14214-50ul 50ul
£113.75
A14214-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14214
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names UBIAD1; SCCD; TERE1; UbiA prenyltransferase domain containing 1
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human UBIAD1 (NP_037451.1).
Reactivity Human
Gene ID 29914
Calculated MW 19kDa/36kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence MAASQVLGEKINILSGETVKAGDRDPLGNDCPEQDRLPQRSWRQKCASYVLALRPWSFSASLTPVALGSALAYRSHGVLDPRLLVGCAVAVLAVHGAGNL
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents