UBE4A Polyclonal AntibodyUBE4A Polyclonal Antibody
Move your mouse over image or click to enlarge

UBE4A Polyclonal Antibody

Cat# Size Price Qty Buy
A3354-200ul 200ul
£332.50
A3354-100ul 100ul
£192.50
A3354-50ul 50ul
£113.75
A3354-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3354
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names UBE4A; E4; UBOX2; UFD2; ubiquitination factor E4A
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 797-1066 of human UBE4A (NP_001191006.1).
Reactivity Human, Mouse
Gene ID 9354
Calculated MW 122kDa/123kDa
Observed MW 130kDa
Physical Appearance liquid
Purification Affinity purification
Sequence FLLDEAIQYLSKIKIQQIEKDRGEWDSLTPEARREKEAGLQMFGQLARFHNIMSNETIGTLAFLTSEIKSLFVHPFLAERIISMLNYFLQHLVGPKMGALKVKDFSEFDFKPQQLVSDICTIYLNLGDEENFCATVPKDGRSYSPTLFAQTVRVLKKINKPGNMIMAFSNLAERIKSLADLQQQEEETYADACDEFLDPIMSTLMCDPVVLPSSRVTVDRSTIARHLLSDQTDPFNRSPLTMDQIRPNTELKEKIQRWLAERKQQKEQLE
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents