UBE2L6 Polyclonal AntibodyUBE2L6 Polyclonal Antibody
Move your mouse over image or click to enlarge

UBE2L6 Polyclonal Antibody

Cat# Size Price Qty Buy
A13670-200ul 200ul
£332.50
A13670-100ul 100ul
£192.50
A13670-50ul 50ul
£113.75
A13670-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13670
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names UBE2L6; RIG-B; UBCH8; ubiquitin conjugating enzyme E2 L6
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human UBE2L6 (NP_004214.1).
Reactivity Human, Mouse, Rat
Gene ID 9246
Calculated MW 10kDa/17kDa
Observed MW 18kDa
Physical Appearance liquid
Purification Affinity purification
Sequence AFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents