UBE2L3 Polyclonal AntibodyUBE2L3 Polyclonal Antibody
Move your mouse over image or click to enlarge

UBE2L3 Polyclonal Antibody

Cat# Size Price Qty Buy
A4175-200ul 200ul
£332.50
A4175-100ul 100ul
£192.50
A4175-50ul 50ul
£113.75
A4175-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4175
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names UBE2L3; E2-F1; L-UBC; UBCH7; UbcM4; ubiquitin-conjugating enzyme E2 L3
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 73-212 of human UBE2L3 (NP_001243284.1).
Reactivity Human, Mouse, Rat
Gene ID 7332
Calculated MW 14kDa/17kDa/24kDa
Observed MW 18kDa
Physical Appearance liquid
Purification Affinity purification
Sequence RKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD
Sensitivity WB,1:1000 - 1:2000|IHC,1:50 - 1:100|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents