UBAC2 Polyclonal AntibodyUBAC2 Polyclonal Antibody
Move your mouse over image or click to enlarge

UBAC2 Polyclonal Antibody

Cat# Size Price Qty Buy
A15975-20ul 20ul
£77.00
A15975-50ul 50ul
£113.75
A15975-100ul 100ul
£192.50
A15975-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15975
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names UBAC2; PHGDHL1; UBA domain containing 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 220-310 of human UBAC2 (NP_001137544.1).
Reactivity Human, Rat
Gene ID 337867
Calculated MW 15kDa/18kDa/26kDa/34kDa/38kDa
Observed MW 39kDa
Physical Appearance liquid
Purification Affinity purification
Sequence PIFSSSEPTSEARIGMGATLDIQRQQRMELLDRQLMFSQFAQGRRQRQQQGGMINWNRLFPPLRQRQNVNYQGGRQSEPAAPPLEVSEEQV
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents