U2AF1 Polyclonal AntibodyU2AF1 Polyclonal Antibody
Move your mouse over image or click to enlarge

U2AF1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13166-200ul 200ul
£332.50
A13166-100ul 100ul
£192.50
A13166-50ul 50ul
£113.75
A13166-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13166
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names U2AF1; FP793; RN; RNU2AF1; U2AF35; U2AFBP; splicing factor U2AF 35 kDa subunit
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human U2AF1 (NP_006749.1).
Reactivity Human, Mouse, Rat
Gene ID 7307
Calculated MW 8kDa/19kDa/27kDa
Observed MW 38kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNIYRNPQNSSQSADGLRCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMN
Sensitivity WB,1:500 - 1:2000|IHC,1:100 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents