TSTA3 Polyclonal AntibodyTSTA3 Polyclonal Antibody
Move your mouse over image or click to enlarge

TSTA3 Polyclonal Antibody

Cat# Size Price Qty Buy
A4169-200ul 200ul
£332.50
A4169-100ul 100ul
£192.50
A4169-50ul 50ul
£113.75
A4169-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4169
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TSTA3; FX; P35B; SDR4E1; GDP-L-fucose synthase
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-321 of human TSTA3 (NP_003304.1).
Reactivity Human, Mouse
Gene ID 7264
Calculated MW 35kDa
Observed MW 36kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARK
Sensitivity WB,1:1000 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents