TSR1 Polyclonal AntibodyTSR1 Polyclonal Antibody
Move your mouse over image or click to enlarge

TSR1 Polyclonal Antibody

Cat# Size Price Qty Buy
A4842-200ul 200ul
£332.50
A4842-100ul 100ul
£192.50
A4842-50ul 50ul
£113.75
A4842-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4842
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TSR1; TSR1, ribosome maturation factor
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 455-804 of human TSR1 (NP_060598.3).
Reactivity Human, Mouse
Gene ID 55720
Calculated MW 91kDa
Observed MW 110kDa
Physical Appearance liquid
Purification Affinity purification
Sequence HDDLYDKKVDEEAEAKMLEKYKQERLEEMFPDEVDTPRDVAARIRFQKYRGLKSFRTSPWDPKENLPQDYARIFQFQNFTNTRKSIFKEVEEKEVEGAEVGWYVTLHVSEVPVSVVECFRQGTPLIAFSLLPHEQKMSVLNMVVRRDPGNTEPVKAKEELIFHCGFRRFRASPLFSQHTAADKHKLQRFLTADMALVATVYAPITFPPASVLLFKQKSNGMHSLIATGHLMSVDPDRMVIKRVVLSGHPFKIFTKMAVVRYMFFNREDVLWFKPVELRTKWGRRGHIKEPLGTHGHMKCSFDGKLKSQDTVLMNLYKRVFPKWTYDPYVPEPVPWLKSEISSTVPQGGME
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents