TSPAN8 Polyclonal AntibodyTSPAN8 Polyclonal Antibody
Move your mouse over image or click to enlarge

TSPAN8 Polyclonal Antibody

Cat# Size Price Qty Buy
A13267-200ul 200ul
£332.50
A13267-100ul 100ul
£192.50
A13267-50ul 50ul
£113.75
A13267-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13267
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TSPAN8; CO-029; TM4SF3; tetraspanin-8
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 110-200 of human TSPAN8 (NP_004607.1).
Reactivity Human, Mouse, Rat
Gene ID 7103
Calculated MW 26kDa
Observed MW 26kDa
Physical Appearance liquid
Purification Affinity purification
Sequence KSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKD
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents