TSC2 Polyclonal AntibodyTSC2 Polyclonal Antibody
Move your mouse over image or click to enlarge

TSC2 Polyclonal Antibody

Cat# Size Price Qty Buy
A16007-20ul 20ul
£77.00
A16007-50ul 50ul
£113.75
A16007-100ul 100ul
£192.50
A16007-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16007
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TSC2; LAM; PPP1R160; TSC4; tuberin
Applications IF, IHC
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 900-1150 of human TSC2 (NP_000539.2).
Reactivity Human, Mouse, Rat
Gene ID 7249
Calculated MW 25kDa/187-200kDa
Physical Appearance liquid
Purification Affinity purification
Sequence CRLPFRKDFVPFITKGLRSNVLLSFDDTPEKDSFRARSTSLNERPKSLRIARPPKQGLNNSPPVKEFKESSAAEAFRCRSISVSEHVVRSRIQTSLTSASLGSADENSVAQADDSLKNLHLELTETCLDMMARYVFSNFTAVPKRSPVGEFLLAGGRTKTWLVGNKLVTVTTSVGTGTRSLLGLDSGELQSGPESSSSPGVHVRQTKEAPAKLESQAGQQVSRGARDRVRSMSGGHGLRVGALDVPASQFL
Sensitivity IHC,1:50 - 1:100|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents