TRMT2B Polyclonal AntibodyTRMT2B Polyclonal Antibody
Move your mouse over image or click to enlarge

TRMT2B Polyclonal Antibody

Cat# Size Price Qty Buy
A3509-200ul 200ul
£332.50
A3509-100ul 100ul
£192.50
A3509-50ul 50ul
£113.75
A3509-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3509
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TRMT2B; CXorf34; dJ341D10.3; tRNA methyltransferase 2 homolog B
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human TRMT2B (NP_079193.2).
Reactivity Human, Rat
Gene ID 79979
Calculated MW 51kDa/55kDa/56kDa
Observed MW 45kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAGLKRRVPLHSLRYFISMVGLFSKPGLLPWYARNPPGWSQLFLGTVCKGDFTRVIATKCQKGQKSQKKPSHLGPLDGSWQERLADVVTPLWRLSYEEQLKVKFAAQKKILQRLESYIQMLNGVSVTTAVPKSERLSCLLHPIIPSPVINGYRNKSTFSVNRGPDGNPKTVGFYLGTWRDGNVVCVQSNHLKNIPEKHSQVAQYYEVFLRQSPLEPCLVFHEGGYWRELTVRTNSQGHTMAIITFHPQKL
Sensitivity WB,1:1000 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents