TRMT112 Polyclonal AntibodyTRMT112 Polyclonal Antibody
Move your mouse over image or click to enlarge

TRMT112 Polyclonal Antibody

Cat# Size Price Qty Buy
A14310-200ul 200ul
£332.50
A14310-100ul 100ul
£192.50
A14310-50ul 50ul
£113.75
A14310-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14310
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TRMT112; HSPC152; HSPC170; TRM112; TRMT11-2; hTrm112; tRNA methyltransferase 11-2 homolog (S. cerevisiae)
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human TRMT112 (NP_057488.1).
Reactivity Human, Mouse, Rat
Gene ID 51504
Calculated MW 13kDa/14kDa
Observed MW Refer to Figures
Physical Appearance liquid
Purification Affinity purification
Sequence MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents