TRIM65 Polyclonal AntibodyTRIM65 Polyclonal Antibody
Move your mouse over image or click to enlarge

TRIM65 Polyclonal Antibody

Cat# Size Price Qty Buy
A14458-200ul 200ul
£332.50
A14458-100ul 100ul
£192.50
A14458-50ul 50ul
£113.75
A14458-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14458
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TRIM65; 4732463G12Rik; tripartite motif containing 65
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 380-490 of human TRIM65 (NP_775818.2).
Reactivity Human, Mouse, Rat
Gene ID 201292
Calculated MW 57kDa
Observed MW Refer to Figures
Physical Appearance liquid
Purification Affinity purification
Sequence QAGHHYWEVRASDHSVTLGVSYPQLPRCRLGPHTDNIGRGPCSWGLCVQEDSLQAWHNGEAQRLPGVSGRLLGMDLDLASGCLTFYSLEPQTQPLYTFHALFNQPLTPVFW
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents