TRIM59 Polyclonal AntibodyTRIM59 Polyclonal Antibody
Move your mouse over image or click to enlarge

TRIM59 Polyclonal Antibody

Cat# Size Price Qty Buy
A13876-200ul 200ul
£332.50
A13876-100ul 100ul
£192.50
A13876-50ul 50ul
£113.75
A13876-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13876
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TRIM59; IFT80L; MRF1; RNF104; TRIM57; TSBF1; tripartite motif containing 59
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-330 of human TRIM59 (NP_775107.1).
Reactivity Human, Mouse, Rat
Gene ID 286827
Calculated MW 47kDa/123kDa
Observed MW 50kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MHNFEEELTCPICYSIFEDPRVLPCSHTFCRNCLENILQASGNFYIWRPLRIPLKCPNCRSITEIAPTGIESLPVNFALRAIIEKYQQEDHPDIVTCPEHYRQPLNVYCLLDKKLVCGHCLTIGQHHGHPIDDLQSAYLKEKDTPQKLLEQLTDTHWTDLTHLIEKLKEQKSHSEKMIQGDKEAVLQYFKELNDTLEQKKKSFLTALCDVGNLINQEYTPQIERMKEIREQQLELMALTISLQEESPLKFLEKVDDVRQHVQILKQRPLPEVQPVEIYPRVSKILKEEWSRTEIGQIKNVLIPKMKISPKRMSCSWPGKDEKEVEFLKIL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents