TRIM54 Polyclonal AntibodyTRIM54 Polyclonal Antibody
Move your mouse over image or click to enlarge

TRIM54 Polyclonal Antibody

Cat# Size Price Qty Buy
A13111-200ul 200ul
£332.50
A13111-100ul 100ul
£192.50
A13111-50ul 50ul
£113.75
A13111-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13111
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TRIM54; MURF; MURF-3; RNF30; muRF3; tripartite motif containing 54
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 179-358 of human TRIM54 (NP_912730.2).
Reactivity Human, Mouse
Gene ID 57159
Calculated MW 40kDa/44kDa
Observed MW 40kDa
Physical Appearance liquid
Purification Affinity purification
Sequence AMLVAGNDRVQAVITQMEEVCQTIEDNSRRQKQLLNQRFESLCAVLEERKGELLQALAREQEEKLQRVRGLIRQYGDHLEASSKLVESAIQSMEEPQMALYLQQAKELINKVGAMSKVELAGRPEPGYESMEQFTVRVEHVAEMLRTIDFQPGASGEEEEVAPDGEEGSAGPEEERPDGP
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents