TRIM29 Polyclonal AntibodyTRIM29 Polyclonal Antibody
Move your mouse over image or click to enlarge

TRIM29 Polyclonal Antibody

Cat# Size Price Qty Buy
A4576-200ul 200ul
£332.50
A4576-100ul 100ul
£192.50
A4576-50ul 50ul
£113.75
A4576-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4576
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TRIM29; ATDC; tripartite motif containing 29
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 309-588 of human TRIM29 (NP_036233.2).
Reactivity Human, Mouse
Gene ID 23650
Calculated MW 63kDa/65kDa
Observed MW 66kDa
Physical Appearance liquid
Purification Affinity purification
Sequence ILEQNFRDLVRDLEKQKEEVRAALEQREQDAVDQVKVIMDALDERAKVLHEDKQTREQLHSISDSVLFLQEFGALMSNYSLPPPLPTYHVLLEGEGLGQSLGNFKDDLLNVCMRHVEKMCKADLSRNFIERNHMENGGDHRYVNNYTNSFGGEWSAPDTMKRYSMYLTPKGGVRTSYQPSSPGRFTKETTQKNFNNLYGTKGNYTSRVWEYSSSIQNSDNDLPVVQGSSSFSLKGYPSLMRSQSPKAQPQTWKSGKQTMLSHYRPFYVNKGNGIGSNEAP
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents