TRIM27 Polyclonal AntibodyTRIM27 Polyclonal Antibody
Move your mouse over image or click to enlarge

TRIM27 Polyclonal Antibody

Cat# Size Price Qty Buy
A16065-20ul 20ul
£77.00
A16065-50ul 50ul
£113.75
A16065-100ul 100ul
£192.50
A16065-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16065
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TRIM27; RFP; RNF76; zinc finger protein RFP
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human TRIM27 (NP_006501.1).
Reactivity Human, Mouse, Rat
Gene ID 5987
Calculated MW 41kDa/58kDa
Observed MW 58kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MASGSVAECLQQETTCPVCLQYFAEPMMLDCGHNICCACLARCWGTAETNVSCPQCRETFPQRHMRPNRHLANVTQLVKQLRTERPSGPGGEMGVCEKHREPLKLYCEEDQMPICVVCDRSREHRGHSVLPLEEAVEGFKEQIQNQLDHLKRVKDLKKRRRAQGEQARAELLSLTQMEREKIVWEFEQLYHSLKEHEYRL
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents