TRIM2 Polyclonal AntibodyTRIM2 Polyclonal Antibody
Move your mouse over image or click to enlarge

TRIM2 Polyclonal Antibody

Cat# Size Price Qty Buy
A14393-200ul 200ul
£332.50
A14393-100ul 100ul
£192.50
A14393-50ul 50ul
£113.75
A14393-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14393
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TRIM2; CMT2R; RNF86; tripartite motif containing 2
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-300 of human TRIM2 (NP_056086.2).
Reactivity Mouse, Rat
Gene ID 23321
Calculated MW 81kDa/84kDa
Observed MW 81kDa
Physical Appearance liquid
Purification Affinity purification
Sequence GVAALQNNFFITNLMDVLQRTPGSNAEESSILETVTAVAAGKPLSCPNHDGNVMEFYCQSCETAMCRECTEGEHAEHPTVPLKDVVEQHKASLQVQLDAVNKRLPEIDSALQFISEIIHQLTNQKASIVDDIHSTFDELQKTLNVRKSVLLMELEVNYGLKHKVLQSQLDTLLQGQESIKSCSNFTAQALNHGTETEVLLV
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents