TPSB2 Polyclonal AntibodyTPSB2 Polyclonal Antibody
Move your mouse over image or click to enlarge

TPSB2 Polyclonal Antibody

Cat# Size Price Qty Buy
A15887-20ul 20ul
£77.00
A15887-50ul 50ul
£113.75
A15887-100ul 100ul
£192.50
A15887-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15887
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TPSB2; TPS2; tryptaseB; tryptaseC; tryptase beta-2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-275 of human TPSB2 (NP_077078.5).
Reactivity Human, Rat
Gene ID 64499
Calculated MW 30kDa
Observed MW 30kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVRDRYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents