TPRG1L Polyclonal AntibodyTPRG1L Polyclonal Antibody
Move your mouse over image or click to enlarge

TPRG1L Polyclonal Antibody

Cat# Size Price Qty Buy
A15949-20ul 20ul
£77.00
A15949-50ul 50ul
£113.75
A15949-100ul 100ul
£192.50
A15949-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15949
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TPRG1L; FAM79A; h-mover; mover; tumor protein p63 regulated 1 like
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human TPRG1L (NP_877429.2).
Reactivity Mouse, Rat
Gene ID 127262
Calculated MW 23kDa/30kDa
Observed MW 30kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MLQLRDSVDSAGTSPTAVLAAGEEVGAGGGPGGGRPGAGTPLRQTLWPLSIHDPTRRARVKEYFVFRPGSIEQAVEEIRVVVRPVEDGEI
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents