TPM4 Polyclonal AntibodyTPM4 Polyclonal Antibody
Move your mouse over image or click to enlarge

TPM4 Polyclonal Antibody

Cat# Size Price Qty Buy
A4166-200ul 200ul
£332.50
A4166-100ul 100ul
£192.50
A4166-50ul 50ul
£113.75
A4166-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4166
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TPM4; HEL-S-108; tropomyosin 4
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-248 of human TPM4 (NP_003281.1).
Reactivity Mouse, Rat
Gene ID 7171
Calculated MW 28kDa/32kDa
Observed MW 36kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTVAKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents