TPH2 Polyclonal AntibodyTPH2 Polyclonal Antibody
Move your mouse over image or click to enlarge

TPH2 Polyclonal Antibody

Cat# Size Price Qty Buy
A14520-200ul 200ul
£332.50
A14520-100ul 100ul
£192.50
A14520-50ul 50ul
£113.75
A14520-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14520
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TPH2; ADHD7; NTPH; tryptophan hydroxylase 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TPH2 (NP_775489.2).
Reactivity Human, Mouse, Rat
Gene ID 121278
Calculated MW 56kDa
Observed MW 54-56kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MQPAMMMFSSKYWARRGFSLDSAVPEEHQLLGSSTLNKPNSGKNDDKGNKGSSKREAATESGKTAVVFSLKNEVGGLVKALRLFQEKRVNMVHIESRKSR
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents