TP53I13 Polyclonal AntibodyTP53I13 Polyclonal Antibody
Move your mouse over image or click to enlarge

TP53I13 Polyclonal Antibody

Cat# Size Price Qty Buy
A15924-20ul 20ul
£77.00
A15924-50ul 50ul
£113.75
A15924-100ul 100ul
£192.50
A15924-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15924
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TP53I13; DSCP1; tumor protein p53-inducible protein 13
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 180-310 of human TP53I13 (NP_612358.3).
Reactivity Mouse, Rat
Gene ID 90313
Calculated MW 42kDa
Observed MW 55kDa
Physical Appearance liquid
Purification Affinity purification
Sequence RSWRPPGTEVTSQGPRQPSSSGAKRRRLRAALGPQPTRSALRFPSASPGSLKAKQSMAGIPGRESNAPSVPTVSLLPGAPGGNASSRTEAQVPNGQGSPGGCVCSSQASPAPRAAAPPRAARGPTPRTEEA
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents