TP53AIP1 Polyclonal AntibodyTP53AIP1 Polyclonal Antibody
Move your mouse over image or click to enlarge

TP53AIP1 Polyclonal Antibody

Cat# Size Price Qty Buy
A14146-200ul 200ul
£332.50
A14146-100ul 100ul
£192.50
A14146-50ul 50ul
£113.75
A14146-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14146
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TP53AIP1; P53AIP1; p53-regulated apoptosis-inducing protein 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-108 of human TP53AIP1 (NP_001238893.1).
Reactivity Human, Mouse, Rat
Gene ID 63970
Calculated MW 8kDa/11kDa/12kDa
Observed MW 13kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MGSSSEASFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSPCSENRDGLLPATAPGRLCSHRGADIPSFQTHQDPVTASGSSELHADCPQFRALDRAGN
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents