TOMM22 Polyclonal AntibodyTOMM22 Polyclonal Antibody
Move your mouse over image or click to enlarge

TOMM22 Polyclonal Antibody

Cat# Size Price Qty Buy
A14548-200ul 200ul
£332.50
A14548-100ul 100ul
£192.50
A14548-50ul 50ul
£113.75
A14548-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14548
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TOMM22; 1C9-2; MST065; MSTP065; TOM22; translocase of outer mitochondrial membrane 22
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-83 of human TOMM22 (NP_064628.1).
Reactivity Human, Mouse
Gene ID 56993
Calculated MW 15kDa
Observed MW 16kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRA
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents