TNPO1 Polyclonal AntibodyTNPO1 Polyclonal Antibody
Move your mouse over image or click to enlarge

TNPO1 Polyclonal Antibody

Cat# Size Price Qty Buy
A14015-200ul 200ul
£332.50
A14015-100ul 100ul
£192.50
A14015-50ul 50ul
£113.75
A14015-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14015
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TNPO1; IPO2; KPNB2; MIP; MIP1; TRN; transportin-1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 800 to the C-terminus of human TNPO1 (NP_002261.3).
Reactivity Human, Mouse, Rat
Gene ID 3842
Calculated MW 96kDa/101kDa/102kDa
Observed MW 102kDa
Physical Appearance liquid
Purification Affinity purification
Sequence QFIRPWCTSLRNIRDNEEKDSAFRGICTMISVNPSGVIQDFIFFCDAVASWINPKDDLRDMFCKILHGFKNQVGDENWRRFSDQFPLPLKERLAAFYGV
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents