TNFRSF19 Polyclonal AntibodyTNFRSF19 Polyclonal Antibody
Move your mouse over image or click to enlarge

TNFRSF19 Polyclonal Antibody

Cat# Size Price Qty Buy
A14284-200ul 200ul
£332.50
A14284-100ul 100ul
£192.50
A14284-50ul 50ul
£113.75
A14284-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14284
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TNFRSF19; TAJ; TAJ-alpha; TRADE; TROY; TNF receptor superfamily member 19
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-170 of human TNFRSF19 (NP_061117.2).
Reactivity Human
Gene ID 55504
Calculated MW 30kDa/45kDa/46kDa
Observed MW 46kDa
Physical Appearance liquid
Purification Affinity purification
Sequence ESGDCRQQEFRDRSGNCVPCNQCGPGMELSKECGFGYGEDAQCVTCRLHRFKEDWGFQKCKPCLDCAVVNRFQKANCSATSDAICGDCLPGFYRKTKLVGFQDMECVPCGDPPPPYEPHCASKVNLVKIASTASSPRDTAL
Sensitivity WB,1:500 - 1:1000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents