TMEM59 Polyclonal AntibodyTMEM59 Polyclonal Antibody
Move your mouse over image or click to enlarge

TMEM59 Polyclonal Antibody

Cat# Size Price Qty Buy
A16089-20ul 20ul
£77.00
A16089-50ul 50ul
£113.75
A16089-100ul 100ul
£192.50
A16089-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16089
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TMEM59; C1orf8; DCF1; HSPC001; PRO195; UNQ169; transmembrane protein 59
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 36-230 of human TMEM59 (NP_004863.2).
Reactivity Human
Gene ID 9528
Calculated MW 36kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence EAFDSVLGDTASCHRACQLTYPLHTYPKEEELYACQRGCRLFSICQFVDDGIDLNRTKLECESACTEAYSQSDEQYACHLGCQNQLPFAELRQEQLMSLMPKMHLLFPLTLVRSFWSDMMDSAQSFITSSWTFYLQADDGKIVIFQSKPEIQYAPHLEQEPTNLRESSLSKMSYLQMRNSQAHRNFLEDGESDGF
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents