TLR3 Polyclonal AntibodyTLR3 Polyclonal Antibody
Move your mouse over image or click to enlarge

TLR3 Polyclonal Antibody

Cat# Size Price Qty Buy
A1449-200ul 200ul
£332.50
A1449-100ul 100ul
£192.50
A1449-50ul 50ul
£113.75
A1449-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A1449
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TLR3; CD283; IIAE2; toll-like receptor 3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 740-904 of human TLR3 (NP_003256.1).
Reactivity Human
Gene ID 7098
Calculated MW 72kDa/103kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence RVLGFKEIDRQTEQFEYAAYIIHAYKDKDWVWEHFSSMEKEDQSLKFCLEERDFEAGVFELEAIVNSIKRSRKIIFVITHHLLKDPLCKRFKVHHAVQQAIEQNLDSIILVFLEEIPDYKLNHALCLRRGMFKSHCILNWPVQKERIGAFRHKLQVALGSKNSVH
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents