TINAGL1 Polyclonal AntibodyTINAGL1 Polyclonal Antibody
Move your mouse over image or click to enlarge

TINAGL1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13122-200ul 200ul
£332.50
A13122-100ul 100ul
£192.50
A13122-50ul 50ul
£113.75
A13122-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13122
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TINAGL1; ARG1; LCN7; LIECG3; TINAGRP; tubulointerstitial nephritis antigen-like
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 258-467 of human TINAGL1 (NP_071447.1).
Reactivity Human, Mouse, Rat
Gene ID 64129
Calculated MW 30kDa/48kDa/52kDa
Observed MW 52kDa
Physical Appearance liquid
Purification Affinity purification
Sequence NLLSCDTHQQQGCRGGRLDGAWWFLRRRGVVSDHCYPFSGRERDEAGPAPPCMMHSRAMGRGKRQATAHCPNSYVNNNDIYQVTPVYRLGSNDKEIMKELMENGPVQALMEVHEDFFLYKGGIYSHTPVSLGRPERYRRHGTHSVKITGWGEETLPDGRTLKYWTAANSWGPAWGERGHFRIVRGVNECDIESFVLGVWGRVGMEDMGHH
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents