TGFBR2 Polyclonal AntibodyTGFBR2 Polyclonal Antibody
Move your mouse over image or click to enlarge

TGFBR2 Polyclonal Antibody

Cat# Size Price Qty Buy
A1415-200ul 200ul
£332.50
A1415-100ul 100ul
£192.50
A1415-50ul 50ul
£113.75
A1415-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A1415
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TGFBR2; AAT3; FAA3; LDS1B; LDS2; LDS2B; MFS2; RIIC; TAAD2; TGFR-2; TGFbeta-RII; TGF-beta receptor type-2
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 23-280 of human TGFBR2 (NP_003233.4).
Reactivity Human, Mouse, Rat
Gene ID 7048
Calculated MW 64kDa/67kDa
Observed MW 75kDa
Physical Appearance liquid
Purification Affinity purification
References PMID 30529267
Sequence TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQVTGISLLPPLGVAISVIIIFYCYRVNRQQKLSSTWETGKTRKLMEFSEHCAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFP
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents