TFF1 Polyclonal AntibodyTFF1 Polyclonal Antibody
Move your mouse over image or click to enlarge

TFF1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13358-200ul 200ul
£332.50
A13358-100ul 100ul
£192.50
A13358-50ul 50ul
£113.75
A13358-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13358
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TFF1; BCEI; D21S21; HP1.A; HPS2; pNR-2; pS2; trefoil factor 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 25-84 of human TFF1 (NP_003216.1).
Reactivity Mouse, Rat
Gene ID 7031
Calculated MW 9kDa
Observed MW 13kDa
Physical Appearance liquid
Purification Affinity purification
Sequence EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents