TFDP2 Polyclonal AntibodyTFDP2 Polyclonal Antibody
Move your mouse over image or click to enlarge

TFDP2 Polyclonal Antibody

Cat# Size Price Qty Buy
A4152-200ul 200ul
£332.50
A4152-100ul 100ul
£192.50
A4152-50ul 50ul
£113.75
A4152-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4152
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TFDP2; DP2; transcription factor Dp-2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 287-386 of human TFDP2 (NP_006277.1).
Reactivity Mouse
Gene ID 7029
Calculated MW 34kDa/39kDa/40kDa/41kDa/42kDa/46kDa/49kDa
Observed MW 50kDa
Physical Appearance liquid
Purification Affinity purification
Sequence GYITDISTGPSWLNQGLLLNSTQSVSNLDLTTGATLPQSSVNQGLCLDAEVALATGQFLAPNSHQSSSAASHCSESRGETPCSFNDEDEEDDEEDSSSPE
Sensitivity WB,1:200 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents