TFAP2B Polyclonal AntibodyTFAP2B Polyclonal Antibody
Move your mouse over image or click to enlarge

TFAP2B Polyclonal Antibody

Cat# Size Price Qty Buy
A13885-200ul 200ul
£332.50
A13885-100ul 100ul
£192.50
A13885-50ul 50ul
£113.75
A13885-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13885
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TFAP2B; AP-2B; AP2-B; PDA2; transcription factor AP-2-beta
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human TFAP2B (NP_003212.2).
Reactivity Mouse
Gene ID 7021
Calculated MW 50kDa/51kDa
Observed MW 45kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MHSPPRDQAAIMLWKLVENVKYEDIYEDRHDGVPSHSSRLSQLGSVSQGPYSSAPPLSHTPSSDFQPPYFPPPYQPLPYHQSQDPYSHVNDPYSLNPLHQPQQHPWGQRQRQEVGSEAGSLLPQPRAALPQLSGLDPRRDYHSVRRPDVLLHSAHHGLDA
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents