TESK2 Polyclonal AntibodyTESK2 Polyclonal Antibody
Move your mouse over image or click to enlarge

TESK2 Polyclonal Antibody

Cat# Size Price Qty Buy
A13395-200ul 200ul
£332.50
A13395-100ul 100ul
£192.50
A13395-50ul 50ul
£113.75
A13395-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13395
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TESK2; testis-specific kinase 2
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 302-571 of human TESK2 (NP_009101.2).
Reactivity Human, Mouse
Gene ID 10420
Calculated MW 60kDa/61kDa/63kDa
Observed MW 64kDa
Physical Appearance liquid
Purification Affinity purification
Sequence FVEIGKTLEEILSRLQEEEQERDRKLQPTARGLLEKAPGVKRLSSLDDKIPHKSPCPRRTIWLSRSQSDIFSRKPPRTVSVLDPYYRPRDGAARTPKVNPFSARQDLMGGKIKFFDLPSKSVISLVFDLDAPGPGTMPLADWQEPLAPPIRRWRSLPGSPEFLHQEACPFVGREESLSDGPPPRLSSLKYRVKEIPPFRASALPAAQAHEAMDCSILQEENGFGSRPQGTSPCPAGASEEMEVEERPAGSTPATFSTSGIGLQTQGKQDG
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents