TERT Polyclonal AntibodyTERT Polyclonal Antibody
Move your mouse over image or click to enlarge

TERT Polyclonal Antibody

Cat# Size Price Qty Buy
A2979-200ul 200ul
£332.50
A2979-100ul 100ul
£192.50
A2979-50ul 50ul
£113.75
A2979-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A2979
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TERT; CMM9; DKCA2; DKCB4; EST2; PFBMFT1; TCS1; TP2; TRT; hEST2; hTRT; telomerase reverse transcriptase
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1000 to the C-terminus of human TERT (NP_937983.2).
Reactivity Human, Rat
Gene ID 7015
Calculated MW 88kDa/90kDa/120kDa/126kDa
Observed MW 127kDa
Physical Appearance liquid
Purification Affinity purification
Sequence NIYKILLLQAYRFHACVLQLPFHQQVWKNPTFFLRVISDTASLCYSILKAKNAGMSLGAKGAAGPLPSEAVQWLCHQAFLLKLTRHRVTYVPLLGSLRTAQTQLSRKLPGTTLTALEAAANPALPSDFKTILD
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents