TEAD1 Polyclonal AntibodyTEAD1 Polyclonal Antibody
Move your mouse over image or click to enlarge

TEAD1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13366-200ul 200ul
£332.50
A13366-100ul 100ul
£192.50
A13366-50ul 50ul
£113.75
A13366-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13366
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TEAD1; AA; NTEF-1; REF1; TCF-13; TCF13; TEAD-1; TEF-1; TEA domain transcription factor 1
Applications ChIP, IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 135-215 of human TEAD1 (NP_068780.2).
Reactivity Human, Mouse
Gene ID 7003
Calculated MW 40kDa/47kDa
Observed MW 48kDa
Physical Appearance liquid
Purification Affinity purification
Sequence AIHNKLGLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASAPAPSVPAWQGRSIGTTK
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200|IF,1:50 - 1:200|CHIP,1:20 - 1:50
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents